wanna nosebleed?

hehe. wala lang. trip ko lang ipost ang discussion namin para sa bio presentation on ecology & evolution XD asa namang may magbabasa nitong buo unless sobrang wala cyang magawa. mwahahaha. baka magamit din sa pagrereview just in case. :P

frances: ano na ba nagawa? hehe.
belsha: ano nga ba~
belsha: invite niyo si nyon XD
neil: "research"
frances: ol na ba un?
belsha: yeh
belsha: invi lang~
frances: Ÿ How are DNA probes and PCR technology used for monitoring microorganisms in the environment (i.e. water quality tests)?

Ÿ How is DNA technology used to break the cycle of disease in nature (i.e. intervention in the life cycle of parasites)?

Ÿ What are applications of DNA technology in taxonomic classification? How is it used to establish that a particular organism is, for example, a separate or a new species?

Ÿ How is DNA technology used in the field of molecular paleontology? What is the value of recovering DNA from fossilized specimens?

Ÿ How was DNA technology used to trace the movements of the human population from its African birthplace?

Ÿ What issues attend the cloning of extinct animals?
neon has joined the conference.

neon: hello guys
frances: ano na'ng nagawa?
neon: hmmmm, medyo ok ok naman
neon: papasalitain kita ces ha
neon: you shall explain
belsha: niggah ka tlga nyon XDDD gawain mo a XDD
frances: sure. grade naman un eh. [gc gc gc gc gc]
belsha: yay 8D so so~ ano na ngang nagawa? at kailangan pang gawin?
neon: hmmmm, bigay pa kayo ng mga namomonitor na microorganisms besides water tests?
belsha: biological warfare agents @@
neon: ???
neon: explain
belsha: http://www.spectrum.ieee.org/print/1534 <-- ewan ko lang kung yan yun~ yung part na "DNA detection-on-a-chip"
neon: wait, microorganisms belsha
neon: hindi chemicals
belsha: ah joke XD
neon: joke lang
neon: may bacteria
neon: at virus
neon:
neon: sorry
neon: di ko nkita
belsha: lol XD
neon: ano nga ulit ito
neon: yung DNA tech to break cycle of disease?
neon: belsha
neon: may nahanap ka ba tungkol dito
neon: ces?
neon: paano ko kaya masisimulan ito
belsha: diba may nahanap ka na kahapon @@
frances: ung mga bacteria nag-eextract ng heavy metals --- cleaning up toxic mining wastes
frances: wait lang...*research research pa*
neon: i forgot the link.
belsha: lol
neon: ok ok
belsha: http://www.bio-medicine.org/medicine-news-1/Researchers-block-transmission-of-malaria-in-animal-tests-21379-1/
neil: hello. naDC
neon: hmmmm, example intervention in the life cycle of parasites
neil: anu n nanyayari?
neon: bsta tungkol sa malaria yun
belsha: ^ yun na yung khpon XD
neon: tama
neon:
neil: anu n nangyayaro?
neil: *nangyayari?
frances: question 2 na.
neon: ano ulit yung knock out system?
neon: neil, pagpatuloy mo lang yung pinapagawa ko sa iyo sa evolution
neil: anu nga b? ung problems bla bla?
belsha: ung may tatanggalin kang isang gene( gene nga ba?) para may mawalang trait
neon: paano nga ulit yun
neil: here is no adequate explanation for the origin of life from dead chemicals. Even the simplest life form is tremendously complex.
neil: problem ng evolution
neon: sang tanong yun
neil: ung problem ng evolution?
neil: ganyan bng problem hanap mu?o_O
neon: err,msydong mabigat yung words
neon:
neon: nga pala
neon: sa ecology part
neon: may 4 parts yun
neon: Gene probe technology
neon: PCR technology
neon: Gene Knock-out technology
neon: at Gene Taxonomic Comparison, something something
neon: ewan
neon: walang name yata yun
neon: pakiresearch nga, kung may name ang technology behind taxonomic classification
belsha: --> http://www.lexgen.com/discovery/technology/gene-knockout/gene-knockout-technologies.html yung knock-out @@
belsha: un b ung bar coding n cnasabi niyo knina?
neon: ah
neon: tama
neon: Gene barcoding
neon: thanks
neon:
neon: pahanap naman ng animation or pictures or procedure ng knock out tech oh
belsha: zzz
neon: yung link, may isa na dun. kung may animation
neon: yehey
neon: neil
neon: ces
belsha: ano n nangyari friends?
belsha: wth bkt may "zzz" ako diyan O_o
frances: ito ba ung bold? >> http://www.barcodinglife.org/views/login.php
neon: yep
neon: wait
neon: may log in??
neon:
neon: bsta barcode of life
neon: tanong!!
neon: saan ang taxonomic classification? evolution yun or ecology?
neon:
frances: evolution...
neon: ok
neon: belsha, isa pa ngang example ng disease in nature?
neon: na sinasagot ng Knock out technology?
belsha: http://www.medindia.net/News/Gene-Knock-Out-Technology-Knocks-Out-Malaria-Parasite-Channel-37831-2.htm <-- malaria http://www.businesswire.com/portal/site/google/index.jsp?ndmViewId=news_view&newsId=20061231005002&newsLang=en <-- prion-free daw yung cows, resistant sa mad cow disease
frances: barcode of life
- accepts DNA sequences in fasta format & returns taxonomic assignment [if possible, upto species level]
- fasta: text representing either nucleic acid sequences/peptide sequences [nasa wikipedia. pero super complicated. wag na lang/konti lang idiscuss sa assignment ng letters]
- example: if you entered

>seq1
ASTPGHTIIYEAVCLHNDRTTIP
>seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES

may makikitang results...probable species...
frances: tapos regarding cloning of extinct animals...
frances: in Jurassic Park, dinosaurs brought back to life by combining genetic mat'l of extinct animals & amphibians

Tasmanian tiger/Thylacines - viable DNA successfully extracted by Australian Museum geneticists but more copies needed

but as of now, implanted genetically-modified eggs, when fertilized, do not result to a successful offspring [offspring die from illness shortly after birth]
belsha: ano yung optional comment dun sa seq2?
frances: edi pwedeng tanggalin. hehe.
belsha: lol XDD oo nga naman XD
neon: guys,kaya niyo pang magtagal? kasi, para masend ko sa inyo at maexplain natin ng lahat. wala lang. nasa barcode pa lang ako. shyet, ambagal ko. sorry
belsha: sure @@
frances: ok lang.
neon: thanks.
neil: neon. nakuha mu b ung in-im q n issues?
neon: yes
neon: waah, hindi ako makahanap ng animation/method for gene knock out. . .
frances: http://learn.genetics.utah.edu/content/tech/cloning/whyclone/ --> look at #2 & right side...cloning endangered species...
belsha: *segway* bebs~ pde pa print ng english natin? pls 8D
belsha: ano.. ano pa bang hahanapin?
neon: ei, kung matutulog na kayo, sabihin niyo na sa akin ha. baka magtagal pa ito eh. . .
neil: No, thank you.
Yahoo! Messenger: neil has declined to join.
neil has joined the conference.

neil: naDC
neil: @@
belsha: wb~~
neon: waaah
neon: kunti na lang
neon:
neon: i hope
belsha: ano pa ba?
belsha: go go go keribels 8D
neon: kaya niyo bang lahat ng pptx?
belsha: yeh
belsha: i think
frances: di ko sure...
neon: uhm, microsoft 2007
neon: este
neon: microsoft ppt 2007
neon: nga pala, paano pala ito? how is it used to establish that a particular organism is a separate or a new specie?
belsha: anong "it" ?
neil: pag different ung mitochondrial DNA sequence nung species n un s ibang species
neil: ganun ata un
neil: @@
neon: ah, tama. yung mitochondria
neon: hmmm
neon: next question
neon: ano yung DNA tech used in the field of molecular paleontology again?
neil: PCR
neil: teka. check q ulet
frances: basta ineextract ung DNA galing sa fossilized organisms...so PCR nga cguro
frances: pero karamihan ng DNA, nade-degrade na kaya medyo useless na rin ung mga galing daw sa dinosaurs...
frances: o kaya masyadong konti ang supply...
frances: kaya sa endangered species na lang ginagawa para medyo bago pa ung DNA na ma-extract...
neon: at ano naman dun sa human population from africa
neon: anong dna tech
neil: y chromosome testing
belsha: ndi ba yung mga mito-mitochondria pti Y-chromosome din tapos ung mga markers?
neon: owkhie
neil: Mitochondrial DNA testing
neil: un ung tests n gnamit pra matrace ung ancestry
neil: ung sa y chromosome testing. pde lng xa pag puro lalake
neil: like. son-father-grandfather-great grand father
neil: un ang alam ko
belsha: ui bebs ung s mitochondria ano ba nagmumutate din?
neil: ewan. @@
belsha: kk~
neil: nakakaantok. @@
neon: sorry
neon: sorry
belsha: *sampal* kunwari na lang nagising ka XD
neon: kung hindi niyo na kaya
neon: tulog na kayo
neon: sorry kung matagal
neil: isang group tayo. sama-sama magpuyat.
neon: hahaha
neon: nga pala, nakuha niyo ba yung pinadala ko sa email?
belsha: yeh
neil: yeh
belsha: ang comedy may forum ba XDD
frances: oo
neon: hahaha
neon: ok
neon: wait lang
neon: talaga
neon: ang BLAST ba para sa taxonomic classification?
neil: pang check un ng DNA sequence dba
neon: yes
neil: feeling q hndi rn.
neon: kasi
neil: cguro qng sa mga higher level pde
neon: ang alam ko
neil: pero qng species level hndi pde
neon: bago muna maclassify
neon: ichcheck yung sequence
neon: tapos kung gaano ka different
neon: from the previous organism
neon: dun lang madedetermine kung bago ba or hindi
neil: pde cguro
neon: anong magandang visuals sa paleontology?
neil: fossils
neil: bkt prang pangmedicine and health ung category nung gene knock-out technology. @@
neil: or ako lng may tingin nun.
belsha: hmmm tama XDDD
neon: hmmm, hindi ko alam paano maintegrate kasi eh
belsha: ndi pero ang gamit nya kasi sa atin ung dun s may malaria
neon: paano nga ba ang ecology dyan
belsha: ung life cycle nga ng ano nagugulo
belsha: kaka-oL nga pla ni magno @@
neon: kagrupo ba natin si magno?
neil: oo
neil:
belsha: yeh~ XD
neon: ngek
belsha: best answer e XD
neon: pagawan niyo ng something yun
belsha: kya nga O_o
frances: cno pa ba kagroup natin?
belsha: c labs
belsha: ang alam ko siya na dun s ice breaker chever @@
belsha: nyway~~
neon: hmmm,may nagawa na raw si quilab ng QA at icebreaker
neon: pero
neon: waaah
neon: baka around 30+ slides ito
neon: sana maabot natin 30mins time
neil: pagnawala aq. naDC aq nun. @@
belsha: halata naman e XDD kanina pa yang net niyo XD
neon: hahaha
frances: onga. nakakailang invites na ba ako.
neil: marami-rami n.
neil: at bka marami pa
belsha: XDDD
frances: anubayan. wala na naman si kenneth...
belsha: onga noh ano pa lang gagawin niya? ._.
neil: xa n rw matutulog pra sa atin.
neil: jowk
belsha: lol XDDDD
frances: hala. matutulog lang cya for more than 1 day. XD
belsha: XDD
neon: hahaha
neon:
neon: ang sama niyo
neon:
neon: waaah
neon: paano ko sisimulan yung African thing?
neon:
frances: galing sa anong topic?
neon: molecular paleontology
neon: paexplain nga yung mitochondrial at Ychromosome markesr
neon: markers
neil: naiinherit nung daughter ung mtDNA sequence nung mother
neon: si mitochondrial eve?
belsha: kasi diba ang namamana mo yung mitochondrial (kung XX) at Y (kung XY) e ndi naman nagbabago yun unless magka mutation ka~ ung mga mutation n un.. un ung markers tpos prang tetrace nila kung saang marker nanggaling .... yun yung intindi ko anyway @@
neil: huh? anu un?o_O
neil: d q lam ung mitochondrial eve
neil: search q
belsha: siya ang ina ng sangkatauhan @@ (in terms of mitochondrial) XD
neil: ahh.
belsha: ndi nga~ basta ung mitochondrial sa kanya na trace XDD
neon: so mutations ang trinace?
belsha: yeh i think

ayoko nang ituloy. baka bumabaha na sa kaka-nosebleed mo [eep!]