Tuesday, February 17, 2009
wanna nosebleed?
hehe. wala lang. trip ko lang ipost ang discussion namin para sa bio presentation on ecology & evolution XD asa namang may magbabasa nitong buo unless sobrang wala cyang magawa. mwahahaha. baka magamit din sa pagrereview just in case. :P
frances: ano na ba nagawa? hehe.
belsha: ano nga ba~
belsha: invite niyo si nyon XD
neil: "research"
frances: ol na ba un?
belsha: yeh
belsha: invi lang~
frances: How are DNA probes and PCR technology used for monitoring microorganisms in the environment (i.e. water quality tests)?
How is DNA technology used to break the cycle of disease in nature (i.e. intervention in the life cycle of parasites)?
What are applications of DNA technology in taxonomic classification? How is it used to establish that a particular organism is, for example, a separate or a new species?
How is DNA technology used in the field of molecular paleontology? What is the value of recovering DNA from fossilized specimens?
How was DNA technology used to trace the movements of the human population from its African birthplace?
What issues attend the cloning of extinct animals?
neon has joined the conference.
neon: hello guys
frances: ano na'ng nagawa?
neon: hmmmm, medyo ok ok naman
neon: papasalitain kita ces ha
neon: you shall explain
belsha: niggah ka tlga nyon XDDD gawain mo a XDD
frances: sure. grade naman un eh. [gc gc gc gc gc]
belsha: yay 8D so so~ ano na ngang nagawa? at kailangan pang gawin?
neon: hmmmm, bigay pa kayo ng mga namomonitor na microorganisms besides water tests?
belsha: biological warfare agents @@
neon: ???
neon: explain
belsha: http://www.spectrum.ieee.org/print/1534 <-- ewan ko lang kung yan yun~ yung part na "DNA detection-on-a-chip"
neon: wait, microorganisms belsha
neon: hindi chemicals
belsha: ah joke XD
neon: joke lang
neon: may bacteria
neon: at virus
neon:
neon: sorry
neon: di ko nkita
belsha: lol XD
neon: ano nga ulit ito
neon: yung DNA tech to break cycle of disease?
neon: belsha
neon: may nahanap ka ba tungkol dito
neon: ces?
neon: paano ko kaya masisimulan ito
belsha: diba may nahanap ka na kahapon @@
frances: ung mga bacteria nag-eextract ng heavy metals --- cleaning up toxic mining wastes
frances: wait lang...*research research pa*
neon: i forgot the link.
belsha: lol
neon: ok ok
belsha: http://www.bio-medicine.org/medicine-news-1/Researchers-block-transmission-of-malaria-in-animal-tests-21379-1/
neil: hello. naDC
neon: hmmmm, example intervention in the life cycle of parasites
neil: anu n nanyayari?
neon: bsta tungkol sa malaria yun
belsha: ^ yun na yung khpon XD
neon: tama
neon:
neil: anu n nangyayaro?
neil: *nangyayari?
frances: question 2 na.
neon: ano ulit yung knock out system?
neon: neil, pagpatuloy mo lang yung pinapagawa ko sa iyo sa evolution
neil: anu nga b? ung problems bla bla?
belsha: ung may tatanggalin kang isang gene( gene nga ba?) para may mawalang trait
neon: paano nga ulit yun
neil: here is no adequate explanation for the origin of life from dead chemicals. Even the simplest life form is tremendously complex.
neil: problem ng evolution
neon: sang tanong yun
neil: ung problem ng evolution?
neil: ganyan bng problem hanap mu?o_O
neon: err,msydong mabigat yung words
neon:
neon: nga pala
neon: sa ecology part
neon: may 4 parts yun
neon: Gene probe technology
neon: PCR technology
neon: Gene Knock-out technology
neon: at Gene Taxonomic Comparison, something something
neon: ewan
neon: walang name yata yun
neon: pakiresearch nga, kung may name ang technology behind taxonomic classification
belsha: --> http://www.lexgen.com/discovery/technology/gene-knockout/gene-knockout-technologies.html yung knock-out @@
belsha: un b ung bar coding n cnasabi niyo knina?
neon: ah
neon: tama
neon: Gene barcoding
neon: thanks
neon:
neon: pahanap naman ng animation or pictures or procedure ng knock out tech oh
belsha: zzz
neon: yung link, may isa na dun. kung may animation
neon: yehey
neon: neil
neon: ces
belsha: ano n nangyari friends?
belsha: wth bkt may "zzz" ako diyan O_o
frances: ito ba ung bold? >> http://www.barcodinglife.org/views/login.php
neon: yep
neon: wait
neon: may log in??
neon:
neon: bsta barcode of life
neon: tanong!!
neon: saan ang taxonomic classification? evolution yun or ecology?
neon:
frances: evolution...
neon: ok
neon: belsha, isa pa ngang example ng disease in nature?
neon: na sinasagot ng Knock out technology?
belsha: http://www.medindia.net/News/Gene-Knock-Out-Technology-Knocks-Out-Malaria-Parasite-Channel-37831-2.htm <-- malaria http://www.businesswire.com/portal/site/google/index.jsp?ndmViewId=news_view&newsId=20061231005002&newsLang=en <-- prion-free daw yung cows, resistant sa mad cow disease
frances: barcode of life
- accepts DNA sequences in fasta format & returns taxonomic assignment [if possible, upto species level]
- fasta: text representing either nucleic acid sequences/peptide sequences [nasa wikipedia. pero super complicated. wag na lang/konti lang idiscuss sa assignment ng letters]
- example: if you entered
>seq1
ASTPGHTIIYEAVCLHNDRTTIP
>seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES
may makikitang results...probable species...
frances: tapos regarding cloning of extinct animals...
frances: in Jurassic Park, dinosaurs brought back to life by combining genetic mat'l of extinct animals & amphibians
Tasmanian tiger/Thylacines - viable DNA successfully extracted by Australian Museum geneticists but more copies needed
but as of now, implanted genetically-modified eggs, when fertilized, do not result to a successful offspring [offspring die from illness shortly after birth]
belsha: ano yung optional comment dun sa seq2?
frances: edi pwedeng tanggalin. hehe.
belsha: lol XDD oo nga naman XD
neon: guys,kaya niyo pang magtagal? kasi, para masend ko sa inyo at maexplain natin ng lahat. wala lang. nasa barcode pa lang ako. shyet, ambagal ko. sorry
belsha: sure @@
frances: ok lang.
neon: thanks.
neil: neon. nakuha mu b ung in-im q n issues?
neon: yes
neon: waah, hindi ako makahanap ng animation/method for gene knock out. . .
frances: http://learn.genetics.utah.edu/content/tech/cloning/whyclone/ --> look at #2 & right side...cloning endangered species...
belsha: *segway* bebs~ pde pa print ng english natin? pls 8D
belsha: ano.. ano pa bang hahanapin?
neon: ei, kung matutulog na kayo, sabihin niyo na sa akin ha. baka magtagal pa ito eh. . .
neil: No, thank you.
Yahoo! Messenger: neil has declined to join.
neil has joined the conference.
neil: naDC
neil: @@
belsha: wb~~
neon: waaah
neon: kunti na lang
neon:
neon: i hope
belsha: ano pa ba?
belsha: go go go keribels 8D
neon: kaya niyo bang lahat ng pptx?
belsha: yeh
belsha: i think
frances: di ko sure...
neon: uhm, microsoft 2007
neon: este
neon: microsoft ppt 2007
neon: nga pala, paano pala ito? how is it used to establish that a particular organism is a separate or a new specie?
belsha: anong "it" ?
neil: pag different ung mitochondrial DNA sequence nung species n un s ibang species
neil: ganun ata un
neil: @@
neon: ah, tama. yung mitochondria
neon: hmmm
neon: next question
neon: ano yung DNA tech used in the field of molecular paleontology again?
neil: PCR
neil: teka. check q ulet
frances: basta ineextract ung DNA galing sa fossilized organisms...so PCR nga cguro
frances: pero karamihan ng DNA, nade-degrade na kaya medyo useless na rin ung mga galing daw sa dinosaurs...
frances: o kaya masyadong konti ang supply...
frances: kaya sa endangered species na lang ginagawa para medyo bago pa ung DNA na ma-extract...
neon: at ano naman dun sa human population from africa
neon: anong dna tech
neil: y chromosome testing
belsha: ndi ba yung mga mito-mitochondria pti Y-chromosome din tapos ung mga markers?
neon: owkhie
neil: Mitochondrial DNA testing
neil: un ung tests n gnamit pra matrace ung ancestry
neil: ung sa y chromosome testing. pde lng xa pag puro lalake
neil: like. son-father-grandfather-great grand father
neil: un ang alam ko
belsha: ui bebs ung s mitochondria ano ba nagmumutate din?
neil: ewan. @@
belsha: kk~
neil: nakakaantok. @@
neon: sorry
neon: sorry
belsha: *sampal* kunwari na lang nagising ka XD
neon: kung hindi niyo na kaya
neon: tulog na kayo
neon: sorry kung matagal
neil: isang group tayo. sama-sama magpuyat.
neon: hahaha
neon: nga pala, nakuha niyo ba yung pinadala ko sa email?
belsha: yeh
neil: yeh
belsha: ang comedy may forum ba XDD
frances: oo
neon: hahaha
neon: ok
neon: wait lang
neon: talaga
neon: ang BLAST ba para sa taxonomic classification?
neil: pang check un ng DNA sequence dba
neon: yes
neil: feeling q hndi rn.
neon: kasi
neil: cguro qng sa mga higher level pde
neon: ang alam ko
neil: pero qng species level hndi pde
neon: bago muna maclassify
neon: ichcheck yung sequence
neon: tapos kung gaano ka different
neon: from the previous organism
neon: dun lang madedetermine kung bago ba or hindi
neil: pde cguro
neon: anong magandang visuals sa paleontology?
neil: fossils
neil: bkt prang pangmedicine and health ung category nung gene knock-out technology. @@
neil: or ako lng may tingin nun.
belsha: hmmm tama XDDD
neon: hmmm, hindi ko alam paano maintegrate kasi eh
belsha: ndi pero ang gamit nya kasi sa atin ung dun s may malaria
neon: paano nga ba ang ecology dyan
belsha: ung life cycle nga ng ano nagugulo
belsha: kaka-oL nga pla ni magno @@
neon: kagrupo ba natin si magno?
neil: oo
neil:
belsha: yeh~ XD
neon: ngek
belsha: best answer e XD
neon: pagawan niyo ng something yun
belsha: kya nga O_o
frances: cno pa ba kagroup natin?
belsha: c labs
belsha: ang alam ko siya na dun s ice breaker chever @@
belsha: nyway~~
neon: hmmm,may nagawa na raw si quilab ng QA at icebreaker
neon: pero
neon: waaah
neon: baka around 30+ slides ito
neon: sana maabot natin 30mins time
neil: pagnawala aq. naDC aq nun. @@
belsha: halata naman e XDD kanina pa yang net niyo XD
neon: hahaha
frances: onga. nakakailang invites na ba ako.
neil: marami-rami n.
neil: at bka marami pa
belsha: XDDD
frances: anubayan. wala na naman si kenneth...
belsha: onga noh ano pa lang gagawin niya? ._.
neil: xa n rw matutulog pra sa atin.
neil: jowk
belsha: lol XDDDD
frances: hala. matutulog lang cya for more than 1 day. XD
belsha: XDD
neon: hahaha
neon:
neon: ang sama niyo
neon:
neon: waaah
neon: paano ko sisimulan yung African thing?
neon:
frances: galing sa anong topic?
neon: molecular paleontology
neon: paexplain nga yung mitochondrial at Ychromosome markesr
neon: markers
neil: naiinherit nung daughter ung mtDNA sequence nung mother
neon: si mitochondrial eve?
belsha: kasi diba ang namamana mo yung mitochondrial (kung XX) at Y (kung XY) e ndi naman nagbabago yun unless magka mutation ka~ ung mga mutation n un.. un ung markers tpos prang tetrace nila kung saang marker nanggaling .... yun yung intindi ko anyway @@
neil: huh? anu un?o_O
neil: d q lam ung mitochondrial eve
neil: search q
belsha: siya ang ina ng sangkatauhan @@ (in terms of mitochondrial) XD
neil: ahh.
belsha: ndi nga~ basta ung mitochondrial sa kanya na trace XDD
neon: so mutations ang trinace?
belsha: yeh i think
ayoko nang ituloy. baka bumabaha na sa kaka-nosebleed mo [eep!]
7:10 PM